Loading...
Statistics
Advertisement

Home | Empower Growth
www.dotobe.org/

Dotobe.org

Advertisement
Conversion Technology Metas Server
Dotobe.org is hosted in United States / Miami . Dotobe.org uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Html, Number of used javascripts: 16. First javascripts: Jquery.js, Jquery-migrate.min.js, Frontend-builde...nctions.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 4. Its server type is: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4. Its CMS is: Wordpress.

Technologies in use by Dotobe.org

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 16
  • jquery.js
  • jquery-migrate.min.js
  • frontend-builder-global-functions.js
  • add-to-cart.min.js
  • jquery.blockUI.min.js
  • woocommerce.min.js
  • jquery.cookie.min.js
  • cart-fragments.min.js
  • jquery.mobile.custom.min.js
  • custom.js
  • jquery.fitvids.js
  • waypoints.min.js
  • jquery.magnific-popup.js
  • frontend-builder-scripts.js
  • wp_footer.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4

Powered by

  • PHP/5.6.18

Used plugins, modules

Number of plugins and modules: 4
  • woocommerce
  • ultimate branding
  • custom admin bar files
  • favicons

Google Analytics ID

  • UA-61902744-4

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Dotobe.org

SSL certificate

    • name: /CN=www.duncan-refining.com
    • subject:
      • CN: www.duncan-refining.com
    • hash: 04f34bfa
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 294853003184394618434298306457718050775219
    • validFrom: 160815160300Z
    • validTo: 161113160300Z
    • validFrom_time_t: 1471276980
    • validTo_time_t: 1479052980
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 48:C6:D2:62:F9:95:38:0F:A4:EB:C6:D7:02:22:E5:DF:92:63:17:D5
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:dappercuts.wpdesignerheaven.net, DNS:dappercutsfruitaco.com, DNS:dotobe.org, DNS:duncan-refining.com, DNS:duncanrefiningrecycling.wpdesignerheaven.net, DNS:empowergrowth.wpdesignerheaven.net, DNS:gracebusinessconsulting.com, DNS:gracebusinessconsulting.wpdesignerheaven.net, DNS:guideschool.com, DNS:guideschool.wpdesignerheaven.net, DNS:rosiesgiftsgj.com, DNS:rosiesgiftsgj.wpdesignerheaven.net, DNS:www.dappercuts.wpdesignerheaven.net, DNS:www.dappercutsfruitaco.com, DNS:www.dotobe.org, DNS:www.duncan-refining.com, DNS:www.duncanrefiningrecycling.wpdesignerheaven.net, DNS:www.empowergrowth.wpdesignerheaven.net, DNS:www.gracebusinessconsulting.com, DNS:www.gracebusinessconsulting.wpdesignerheaven.net, DNS:www.guideschool.com, DNS:www.guideschool.wpdesignerheaven.net, DNS:www.rosiesgiftsgj.com, DNS:www.rosiesgiftsgj.wpdesignerheaven.net
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Dotobe.org

Number of occurences: 4
  • Name:
    Content:
  • Name: generator
    Content: Mozaic Technology
  • Name: viewport
    Content: width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0
  • Name: msapplication-TileImage
    Content: http://dotobe.org/wp-content/uploads/sites/106/2016/03/dotobe-1.png

Server / Hosting

  • IP: 104.238.136.13
  • Latitude: 25.81
  • Longitude: -80.24
  • Country: United States
  • City: Miami

Rname

  • ns1.wpdesignerheaven.com
  • b.ns.buddyns.com
  • mail.dotobe.org

Target

  • dorseycoe.gmail.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Wed, 31 Aug 2016 12:47:46 GMT Server: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 X-Powered-By: PHP/5.6.18 X-Pingback: http://dotobe.org/xmlrpc.php Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=aa9b71a11f4c8d0f0ea16e5ca4081d90; path=/ Location: http://dotobe.org/ Vary: User-Agent Content-Length: 0 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Wed, 31 Aug 2016 12:47:49 GMT Server: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 X-Powered-By: PHP/5.6.18 X-Pingback: http://dotobe.org/xmlrpc.php Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Link: ; rel="https://api.w.org/", ; rel=shortlink Set-Cookie: PHPSESSID=0eaee8e0a6a1314952fb7a09e91c35b0; path=/ Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Transfer-Encoding: chunked Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

DNS

host: dotobe.org
  1. class: IN
  2. ttl: 14399
  3. type: A
  4. ip: 104.238.136.13
host: dotobe.org
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns1.wpdesignerheaven.com
host: dotobe.org
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: b.ns.buddyns.com
host: dotobe.org
  1. class: IN
  2. ttl: 14400
  3. type: SOA
  4. mname: ns1.wpdesignerheaven.com
  5. rname: dorseycoe.gmail.com
  6. serial: 2016031400
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: dotobe.org
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mail.dotobe.org
host: dotobe.org
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 +a +mx +ip4:104.238.136.13 ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.otobe.org, www.dtotobe.org, www.totobe.org, www.dgotobe.org, www.gotobe.org, www.dbotobe.org, www.botobe.org, www.dxotobe.org, www.xotobe.org, www.dsotobe.org, www.sotobe.org, www.dfotobe.org, www.fotobe.org, www.dvotobe.org, www.votobe.org, www.dyotobe.org, www.yotobe.org, www.dzotobe.org, www.zotobe.org, www.daotobe.org, www.aotobe.org, www.deotobe.org, www.eotobe.org, www.drotobe.org, www.rotobe.org, www.dtobe.org, www.dobtobe.org, www.dbtobe.org, www.dohtobe.org, www.dhtobe.org, www.dogtobe.org, www.dgtobe.org, www.dojtobe.org, www.djtobe.org, www.domtobe.org, www.dmtobe.org, www.do tobe.org, www.d tobe.org, www.dovtobe.org, www.dvtobe.org, www.doobe.org, www.dotqobe.org, www.doqobe.org, www.dotaobe.org, www.doaobe.org, www.dot obe.org, www.do obe.org, www.dotwobe.org, www.dowobe.org, www.doteobe.org, www.doeobe.org, www.dotzobe.org, www.dozobe.org, www.dotxobe.org, www.doxobe.org, www.dotcobe.org, www.docobe.org, www.dotbe.org, www.dotobbe.org, www.dotbbe.org, www.dotohbe.org, www.dothbe.org, www.dotogbe.org, www.dotgbe.org, www.dotojbe.org, www.dotjbe.org, www.dotombe.org, www.dotmbe.org, www.doto be.org, www.dot be.org, www.dotovbe.org, www.dotvbe.org, www.dotoe.org, www.dotobqe.org, www.dotoqe.org, www.dotobwe.org, www.dotowe.org, www.dotobze.org, www.dotoze.org, www.dotobxe.org, www.dotoxe.org, www.dotobe.org, www.dotoe.org, www.dotobse.org, www.dotose.org, www.dotobye.org, www.dotoye.org, www.dotobee.org, www.dotoee.org, www.dotobde.org, www.dotode.org, www.dotobce.org, www.dotoce.org, www.dotob.org, www.dotobex.org, www.dotobx.org, www.dotobes.org, www.dotobs.org, www.dotobew.org, www.dotobw.org, www.dotober.org, www.dotobr.org, www.dotobef.org, www.dotobf.org, www.dotobev.org, www.dotobv.org, www.dotobec.org, www.dotobc.org, www.dotobeq.org, www.dotobq.org, www.dotobea.org, www.dotoba.org, www.dotobey.org, www.dotoby.org,

Other websites we recently analyzed

  1. Lisavaird Co-Operative Creamery Ltd - Official Website
    Everyone is welcome to shop at and make use of all our services and facilities. Our membership of a Nationwide Co-op Purchasing Group gives us purchasing power, which we are happy to pass on to our customers.
    Ireland - 78.153.215.201
    Server software: Apache/2.2.11 (Unix)
    Technology: CSS, Html, Javascript, jQuery, jQuery Cycle, MooTools, Php, SuperFish, Google Analytics
    Number of Javascript: 11
    Number of meta tags: 4
  2. Building Brands | Bespoke Event Management
    Australia - 202.124.241.203
    Server software: LiteSpeed
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 9
    Number of meta tags: 3
  3. Metropolis City
    Germany - 62.27.5.157
    Server software: Apache/2.2.3 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 2
  4. B∆SEC∆MP
    The official basecamp band website
    Charlotte (United States) - 68.71.99.250
    Server software: Apache/2.2.15 (CentOS)
    Technology: CSS, Html, Javascript, Drupal, Facebook Box, Twitter Button
    Number of Javascript: 2
    Number of meta tags: 6
  5. سوبر ماركت عاشور
    Wasquehal (France) - 194.51.85.81
    Server software: Apache
    Technology: Carousel, CSS, Html, Javascript, jQuery Validate, jQuery UI
    Number of Javascript: 30
    Number of meta tags: 4
  6. sssyj.net
    See related links to what you are looking for.
    New York (United States) - 199.59.243.120
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, Html, Html5, Javascript
    Number of meta tags: 3
  7. Flaring Tool Kit, Tubing Cutter, Double Flaring Tool Manufacturer, Supplier, exporter, factory in Taiwan- Hung Chang Tools Co., Ltd.-Hong Kong India Indonesia Japan Korea Malaysia Middle East Pakistan Philippines Singapore Thailand Vietnam Asian Countri
    Flaring Tool, Tubing Cutter Manufacturer, Supplier, exporter, factory in Taiwan- Hung Chang Tools Co., Ltd.
    Provo (United States) - 69.89.31.160
    Server software: nginx/1.8.1
    Technology: CSS, Google Font API, Html
    Number of Javascript: 3
    Number of meta tags: 6
  8. fanxing.mobi
    Singapore - 116.251.214.80
    Server software: Microsoft-IIS/7.0
    Technology: Html, Iframe
  9. gundm.de steht zum Verkauf
    Germany - 176.9.83.229
    Server software: lighttpd/1.4.18
    Technology: CSS, Html, Html5, Iframe, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  10. Rifki Sahingoz
    Albuquerque (United States) - 129.121.3.188
    Server software: nginx
    Technology: Html
    Number of meta tags: 2

Check Other Websites